Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
Product Information
26038-1-AP targets MLC1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23187 Product name: Recombinant human MLC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 325-377 aa of BC028425 Sequence: QCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLKEFDKEKAWRAVVVQMAQ Predict reactive species |
| Full Name | megalencephalic leukoencephalopathy with subcortical cysts 1 |
| Observed Molecular Weight | 30-35 kDa |
| GenBank Accession Number | BC028425 |
| Gene Symbol | MLC1 |
| Gene ID (NCBI) | 23209 |
| RRID | AB_3669518 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15049 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MLC1 antibody 26038-1-AP | Download protocol |
| WB protocol for MLC1 antibody 26038-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Agric Food Chem Atractylenolide-1 Alleviates Ulcerative Colitis via Restraining RhoA/ROCK/MLC Pathway-Mediated Intestinal Barrier Dysfunction | ||
Ecotoxicol Environ Saf Nonylphenol exposure induces myocardial fibrosis via the RhoA/ROCK1/MLC-signaling pathway |



