MLXIPL Polyclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 13256-1-AP (same clone as 13256-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13256-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 13256-1-AP (same clone as 13256-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13256-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13256-1-AP (same clone as 13256-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13256-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13256-1-AP (same clone as 13256-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13256-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 13256-1-AP (same clone as 13256-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13256-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 13256-1-AP (same clone as 13256-1-PBS)

  IP result of anti-MLXIPL (IP:13256-1-AP, 4ug; Detection:13256-1-AP 1:1000) with HepG2 cells lysate 3600ug. This data was developed using the same antibody clone with 13256-1-PBS in a different storage buffer formulation.

MLXIPL Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 13256-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

13256-1-PBS targets MLXIPL in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3481

  Product name: Recombinant human MLXIPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC012925

  Sequence: MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIELPPEDAYVGNADMIQPDLTPLQPSLDDFMDISDFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAPPTALLQEEPLFSPRFPFPTVPPA

• Full Name: MLX interacting protein-like
• Calculated Molecular Weight: 852 aa, 93 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC012925
• Gene Symbol: MLXIPL
• Gene ID (NCBI): 51085
• RRID: AB_2266665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP71
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Carbohydrate response element-binding protein (ChREBP), also known as MLXIPL, is a glucose-responsive transcription factor that has a fundamental role in the glucose-mediated induction of genes involved in hepatic glycolysis and lipogenesis. Circulating blood glucose levels affect ChREBP activity in hepatocytes largely by post-translational mechanisms that include phosphorylation-dependent subcellular localization [PMID:21665952]. It enhances expression of the liver pyruvate kinase (LPK) gene and all lipogenic enzyme genes resulting in the conversion of excess dietary carbohydrate into triglycerides that can be stored as fat [PMID:15118080]. Molecular Weight of ChREBP splice variants: 62/78/91/93 kDa.