Tested Applications
| Positive WB detected in | mouse liver tissue, human liver tissue, HepG2 cells, HeLa cells, rat liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13256-1-AP targets MLXIPL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3481 Product name: Recombinant human MLXIPL protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC012925 Sequence: MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIELPPEDAYVGNADMIQPDLTPLQPSLDDFMDISDFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAPPTALLQEEPLFSPRFPFPTVPPA Predict reactive species |
| Full Name | MLX interacting protein-like |
| Calculated Molecular Weight | 852 aa, 93 kDa |
| Observed Molecular Weight | 65 kDa |
| GenBank Accession Number | BC012925 |
| Gene Symbol | MLXIPL |
| Gene ID (NCBI) | 51085 |
| RRID | AB_2266665 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NP71 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Carbohydrate response element-binding protein (ChREBP), also known as MLXIPL, is a glucose-responsive transcription factor that has a fundamental role in the glucose-mediated induction of genes involved in hepatic glycolysis and lipogenesis. Circulating blood glucose levels affect ChREBP activity in hepatocytes largely by post-translational mechanisms that include phosphorylation-dependent subcellular localization [PMID:21665952]. It enhances expression of the liver pyruvate kinase (LPK) gene and all lipogenic enzyme genes resulting in the conversion of excess dietary carbohydrate into triglycerides that can be stored as fat [PMID:15118080]. Molecular Weight of ChREBP splice variants: 62/78/91/93 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MLXIPL antibody 13256-1-AP | Download protocol |
| IHC protocol for MLXIPL antibody 13256-1-AP | Download protocol |
| IP protocol for MLXIPL antibody 13256-1-AP | Download protocol |
| WB protocol for MLXIPL antibody 13256-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MLXIPL (ChREBP) Polyclonal antibody (Cat# 13256-1-AP) has 22 citations spanning journals including Science, Phytomedicine, Acta Pharmacol Sin, EMBO Rep, J Ethnopharmacol, Front Pharmacol, and Clin Transl Med. Research fields cover hepatic lipid metabolism, NAFLD/NASH, type 2 diabetes, fatty acid synthesis, vascular aging, atherosclerosis, obesity, alcohol-induced liver injury, and cancer progression.
| Species | Application | Title |
|---|---|---|
Science Liver ALKBH5 regulates glucose and lipid homeostasis independently through GCGR and mTORC1 signaling | ||
Phytomedicine Astragaloside IV delays vascular aging by enhancing mitochondrial fatty acid β-oxidation via the MLXIPL-PPARα/PGC-1α axis.
| ||
Acta Pharmacol Sin 6-Methyl flavone inhibits Nogo-B expression and improves high fructose diet-induced liver injury in mice | ||
Acta Pharmacol Sin Acetyl-CoA synthetase 2 promotes diabetic renal tubular injury in mice by rewiring fatty acid metabolism through SIRT1/ChREBP pathway | ||
Phytother Res A Natural LDHA Allosteric Inhibitor Geraniin Suppresses Triple-Negative Breast Cancer Cell Growth. | ||
Clin Transl Med Phosphoproteome reveals molecular mechanisms of aberrant rhythm in neurotransmitter-mediated islet hormone secretion in diabetic mice. |
Reviews
What customers say
The single review (5/5) was posted on December 17, 2025 by a researcher who used this antibody for Western Blot at a 1:1000 dilution on human adipocyte cells. They confirmed that knockout cells showed no MLXIPL expression, demonstrating the antibody's high specificity and reliability for detecting the target protein.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
ILKNUR (Verified Customer) (12-17-2025) | The knock out cells show no expression of MLXIPL
 |
