MLXIPL Polyclonal antibody

• 

  WB analysis of HepG2 using 13256-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 13256-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 13256-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 13256-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13256-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13256-1-AP (MLXIPL antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 13256-1-AP

  IP result of anti-MLXIPL (IP:13256-1-AP, 4ug; Detection:13256-1-AP 1:1000) with HepG2 cells lysate 3600ug.

MLXIPL Polyclonal Antibody for WB, IP, ELISA

Cat No. 13256-1-AP

Publications(18)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

bHLHd14, CHREBP, MIO, MLX interacting protein like, MLX interactor, MLXIPL, MONDOB, WBSCR14, WS bHLH

---

Tested Applications

• Positive WB detected in: mouse liver tissue, human liver tissue, HepG2 cells, HeLa cells, rat liver tissue
• Positive IP detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 16 publications below
• IHC: See 1 publications below
• IF: See 4 publications below

Product Information

13256-1-AP targets MLXIPL in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3481

  Product name: Recombinant human MLXIPL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-350 aa of BC012925

  Sequence: MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIELPPEDAYVGNADMIQPDLTPLQPSLDDFMDISDFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAPPTALLQEEPLFSPRFPFPTVPPA

• Full Name: MLX interacting protein-like
• Calculated Molecular Weight: 852 aa, 93 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC012925
• Gene Symbol: MLXIPL
• Gene ID (NCBI): 51085
• RRID: AB_2266665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP71
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carbohydrate response element-binding protein (ChREBP), also known as MLXIPL, is a glucose-responsive transcription factor that has a fundamental role in the glucose-mediated induction of genes involved in hepatic glycolysis and lipogenesis. Circulating blood glucose levels affect ChREBP activity in hepatocytes largely by post-translational mechanisms that include phosphorylation-dependent subcellular localization [PMID:21665952]. It enhances expression of the liver pyruvate kinase (LPK) gene and all lipogenic enzyme genes resulting in the conversion of excess dietary carbohydrate into triglycerides that can be stored as fat [PMID:15118080]. Molecular Weight of ChREBP splice variants: 62/78/91/93 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO Rep; Lin28 enhances de novo fatty acid synthesis to promote cancer progression via SREBP-1.; Authors - Yang Zhang
mouse	WB,IHC	Clin Transl Med; Phosphoproteome reveals molecular mechanisms of aberrant rhythm in neurotransmitter-mediated islet hormone secretion in diabetic mice.; Authors - Yunqiang He
mouse		Front Pharmacol; Roxadustat, a Hypoxia-Inducible Factor 1α Activator, Attenuates Both Long- and Short-Term Alcohol-Induced Alcoholic Liver Disease.; Authors - Yongyao Gao
mouse,human	WB	J Agric Food Chem; Diosmetin Ameliorates Nonalcoholic Steatohepatitis through Modulating Lipogenesis and Inflammatory Response in a STAT1/CXCL10-Dependent Manner.; Authors - Nanxuan Luo
human,mouse	WB	J Agric Food Chem; Baicalein Enhances the Effect of Acarbose on the Improvement of Nonalcoholic Fatty Liver Disease Associated with Prediabetes via the Inhibition of De Novo Lipogenesis.; Authors - Yan Xing
human	WB	Food Funct; Polysaccharide MCP extracted from Morchella esculenta reduces atherosclerosis in LDLR-deficient mice.; Authors - Dandan Wang