Product Information
68921-2-PBS targets Neprilysin/CD10 as part of a matched antibody pair:
MP50348-2: 68921-2-PBS capture and 68921-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12506 Product name: Recombinant human MME,CD10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC106070 Sequence: MGKSESQMDITDINTPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSGMVARAYNPRGRRIA Predict reactive species |
Full Name | membrane metallo-endopeptidase |
Calculated Molecular Weight | 80aa,9 kDa; 750aa,85 kDa |
GenBank Accession Number | BC106070 |
Gene Symbol | CD10 |
Gene ID (NCBI) | 4311 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P08473 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |