Tested Applications
| Positive WB detected in | MCF-7 cells, A549 cells, T-47D cells |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
30615-1-AP targets MMP11 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31191 Product name: Recombinant human MMP11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 99-208 aa of NM_005940 Sequence: VLSGGRWEKTDLTYRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFARYWHGDDLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDDQGTD Predict reactive species |
| Full Name | matrix metallopeptidase 11 (stromelysin 3) |
| Calculated Molecular Weight | 55 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | NM_005940 |
| Gene Symbol | MMP11 |
| Gene ID (NCBI) | 4320 |
| RRID | AB_3086374 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24347 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Matrix metalloproteinase 11 (MMP11), also named stromelysin-3, is a member of the stromelysin subgroup belonging to MMPs superfamily. The role of MMP11 in cancer progression has been shown by several preclinical observations: its expression promotes tumor take in mice, homing of malignant epithelial cells, cancer progression by remodeling extracellular matrix, and antiapoptotic and antinecrotic effect on tumor cells (PMID: 19509157, 26892540). The immunoblot demonstrated two separate bands of ~65 kDa (latent proenzyme form) and ~45 kD (active form) of secreted MMP-11 protein (PMID: 21442356).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MMP11 antibody 30615-1-AP | Download protocol |
| WB protocol for MMP11 antibody 30615-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
World J Gastrointest Oncol Transcription factor 3 enhances hepatocellular carcinoma metastasis by upregulating matrix metalloproteinase-11 | ||
Front Immunol Landscape analysis of matrix metalloproteinases reveals key prognostic markers for prostate cancer |





