MMP17 Polyclonal antibody, PBS Only

• 

  WB analysis using 28429-1-AP (same clone as 28429-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28429-1-AP (MMP17 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28429-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 28429-1-AP (same clone as 28429-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28429-1-AP (MMP17 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28429-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 28429-1-AP (same clone as 28429-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 28429-1-AP (MMP17 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28429-1-PBS in a different storage buffer formulation.

MMP17 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 28429-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

28429-1-PBS targets MMP17 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29298

  Product name: Recombinant human MMP17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 356-565 aa of NM_016155

  Sequence: RLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVCSCTS

• Full Name: matrix metallopeptidase 17 (membrane-inserted)
• Calculated Molecular Weight: 67 kDa
• GenBank Accession Number: NM_016155
• Gene Symbol: MMP17
• Gene ID (NCBI): 4326
• RRID: AB_2881140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULZ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.