MMP3 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• MMP3 Monoclonal antibody (66338-1-Ig)

• Featured Product
• KD/KO Validated

MMP3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66338-1-Ig

Clone No.1F5A9

Publications(86)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1F5A9, EC:3.4.24.17, Matrix metalloproteinase-3, MMP 3, MMP-3

• 

  WB analysis using 66338-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66338-1-Ig

  WB result of MMP3 antibody (66338-1-Ig; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-MMP3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66338-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 66338-1-Ig

  human heart tissue were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 66338-1-Ig

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of fetal human brain using 66338-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig heart using 66338-1-Ig

  pig heart tissue were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Caco-2 using 66338-1-Ig

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat colon using 66338-1-Ig

  Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A549 using 66338-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using MMP3 antibody (66338-1-Ig, Clone: 1F5A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: PC-12 cells, human heart tissue, HeLa cells, fetal human brain tissue, COLO 320 cells, Caco-2 cells, pig heart tissue, pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: human breast cancer tissue, human colon cancer tissue, mouse colon tissue, rat colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66338-1-Ig targets MMP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12359

  Product name: Recombinant human MMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-477 aa of BC074869

  Sequence: GEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC

• Full Name: matrix metallopeptidase 3 (stromelysin 1, progelatinase)
• Calculated Molecular Weight: 477 aa, 54 kDa
• Observed Molecular Weight: 45-60 kDa
• GenBank Accession Number: BC074869
• Gene Symbol: MMP3
• Gene ID (NCBI): 4314
• RRID: AB_2881718
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P08254
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Matrix metalloproteinases (MMPs) play a critically important role in extracellular matrix remodeling and have been implicated in a number of key normal and pathologic processes.These proteases have come to represent important therapeutic and diagnostic targets for the treatment and detection of human cancers. MMP-3 activate procollagenase via two pathways: slow direct activation and rapid activation in conjunction with tissue or plasma proteinases. The pro-MMP3 (60 kDa) and the active MMP3 (47 kDa) can be detected through western blot.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mil Med Res; Downregulation of FTO aggravates osteoarthritis with obesity by erasing m(6)A methylation of PDP2.; Authors - Xu-Ying Sun
human	IF	Nat Aging; Comparative analysis of senolytic drugs reveals mitochondrial determinants of efficacy and resistance.; Authors - Masahiro Wakita
human	WB	Nat Commun; The natural flavonoid dihydromyricetin targets senescent cells via PRDX2 and alleviates age-related diseases; Authors - Qixia Xu
		Nat Commun; SLC1A5 prevents aortic aneurysm and dissection by glutaminolytic-epigenetic orchestration of vascular smooth muscle cell homeostasis.; Authors - Pinglian Yang
		Exp Mol Med; Blockade of the vaspin-AP-1 axis inhibits arthritis development; Authors - Jimin Jeon
human	WB	J Nanobiotechnology; Quercetin nanoformulation-embedded hydrogel inhibits osteopontin mediated ferroptosis for intervertebral disc degeneration alleviation; Authors - Jitian Li