Filter: AllWBIHCIF/ICC

WB analysis of HeLa using 66338-1-Ig (same clone as 66338-1-PBS)
WB result of MMP3 antibody (66338-1-Ig; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-MMP3 transfected HeLa cells. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
WB analysis using 66338-1-Ig (same clone as 66338-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
WB analysis of fetal human brain using 66338-1-Ig (same clone as 66338-1-PBS)
fetal human brain tissue were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
WB analysis of pig heart using 66338-1-Ig (same clone as 66338-1-PBS)
pig heart tissue were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
WB analysis of human heart using 66338-1-Ig (same clone as 66338-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
WB analysis of COLO 320 using 66338-1-Ig (same clone as 66338-1-PBS)
COLO 320 cells were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
WB analysis of Caco-2 using 66338-1-Ig (same clone as 66338-1-PBS)
Caco-2 cells were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
WB analysis using 66338-1-Ig (same clone as 66338-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 66338-1-Ig (MMP3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of rat colon using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of human colon cancer using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of mouse colon using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IHC staining of rat colon using 66338-1-Ig (same clone as 66338-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat colon tissue slide using 66338-1-Ig (MMP3 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.
IF Staining of A549 using 66338-1-Ig (same clone as 66338-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using MMP3 antibody (66338-1-Ig, Clone: 1F5A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66338-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

MMP3 Monoclonal antibody, PBS Only

MMP3 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66338-1-PBS

Clone No.1F5A9

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

1F5A9, EC:3.4.24.17, Matrix metalloproteinase-3, MMP 3, MMP-3

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

66338-1-PBS targets MMP3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag12359 Product name: Recombinant human MMP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 26-477 aa of BC074869 Sequence: GEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC Predict reactive species
Full Name	matrix metallopeptidase 3 (stromelysin 1, progelatinase)
Calculated Molecular Weight	477 aa, 54 kDa
Observed Molecular Weight	45-60 kDa
GenBank Accession Number	BC074869
Gene Symbol	MMP3
Gene ID (NCBI)	4314
RRID	AB_2881718
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P08254
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Matrix metalloproteinases (MMPs) play a critically important role in extracellular matrix remodeling and have been implicated in a number of key normal and pathologic processes.These proteases have come to represent important therapeutic and diagnostic targets for the treatment and detection of human cancers. MMP-3 activate procollagenase via two pathways: slow direct activation and rapid activation in conjunction with tissue or plasma proteinases. The pro-MMP3 (60 kDa) and the active MMP3 (47 kDa) can be detected through western blot.