Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, LNCaP cells, U2OS cells, HepG2 cells, Raji cells, MDA-MB-231 cells |
| Positive IHC detected in | human breast cancer tissue, human cervical cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10375-2-AP targets MMP-9 (N-terminal) in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, rabbit, bovine, hamster, goat, fish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0552 Product name: Recombinant human MMP9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC006093 Sequence: MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG Predict reactive species |
| Full Name | matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) |
| Calculated Molecular Weight | 707 aa, 78 kDa |
| Observed Molecular Weight | 92 kDa, 67 kDa |
| GenBank Accession Number | BC006093 |
| Gene Symbol | MMP-9 |
| Gene ID (NCBI) | 4318 |
| RRID | AB_10897178 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14780 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for MMP-9 (N-terminal) antibody 10375-2-AP | Download protocol |
| IF protocol for MMP-9 (N-terminal) antibody 10375-2-AP | Download protocol |
| IHC protocol for MMP-9 (N-terminal) antibody 10375-2-AP | Download protocol |
| WB protocol for MMP-9 (N-terminal) antibody 10375-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MMP-9 (N-terminal) polyclonal antibody (Cat# 10375-2-AP) has accumulated 1,656 citations across high-impact journals including Cell, Nature Communications, Molecular Cancer, Cancer Research, Journal of Advanced Research, Phytomedicine, Biomaterials, Science Advances, and Cell Death & Disease. Cited research spans oncology, cardiovascular disease, bone metabolism, neuroinflammation, wound healing, fibrosis, atherosclerosis, and osteoarthritis, with applications primarily in Western blot, IHC, IF, IP, CoIP, and ELISA.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Human adipose and umbilical cord mesenchymal stem cell-derived extracellular vesicles mitigate photoaging via TIMP1/Notch1 | ||
J Hematol Oncol Ilamycin C induces apoptosis and inhibits migration and invasion in triple-negative breast cancer by suppressing IL-6/STAT3 pathway. | ||
Mol Cancer Alteration of tumor suppressor BMP5 in sporadic colorectal cancer: a genomic and transcriptomic profiling based study. | ||
Mol Cancer MicroRNA-505 functions as a tumor suppressor in endometrial cancer by targeting TGF-α. | ||
Mol Cancer Long non-coding RNA PVT1 promotes tumor progression by regulating the miR-143/HK2 axis in gallbladder cancer. |
Reviews
What customers say
Users report consistently positive results across multiple applications. For Western Blot, the antibody produces clean bands at the expected ~92–100 kDa size, with dilutions of 1:1000 to 1:3000 working well in liver tissue, A549 cells, and macrophage lines. IHC performance is praised for liver and mouse aneurysm sections at 1:100. Immunofluorescence users highlight clear imaging in mesenchymal stromal cells and spinal cord tissue. One reviewer noted slight cross-reactivity with MMP2, but overall the antibody is considered reliable and reproducible, with one user successfully reusing diluted antibody four times.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (11-26-2025) | good for western blot
|
Monica (Verified Customer) (11-14-2025) | Great antibody for detecting MMP9. Gives nice clean bands and works really with 1hr RT incubations as well as over night 4C. Have used the same diluted antibody 4x , and it still giving nice bands.
 |
MALLIKARJUNA (Verified Customer) (11-13-2025) | good for IHC
|
Angie (Verified Customer) (07-24-2024) | A549 lysate was subjected to western blot with MMP9 antibody used at dilution of 1:3000 and incubated at room temperature for 1.5 hours. One strong band (around 92 kDa) was observed.
 |
Siddharth (Verified Customer) (07-18-2023) | Good antibody for IF experiments
|
Christine (Verified Customer) (07-11-2022) | The MMP9 antibody detects nicely a protein with a size of about 100 kD and the blot looks like the blots on the product page
 |
Hongxue (Verified Customer) (01-12-2021) | Clear band for WB
 |
Kyosuke (Verified Customer) (06-12-2019) | I am working on aneurysm study and use this for IHC staining on mouse aneurysm section. It works very well.
|
JIMMY (Verified Customer) (04-15-2019) | This antibody detects MMP9 expressing cells in the spinal cord of C57BL/6 EAE mice. The imaging is quiet clear with this antibody.
|
Lucy (Verified Customer) (03-08-2019) | Reacts mainly to human MMP9 but slightly cross-reactive to human MMP2
 |
