• Featured Product
  • KD/KO Validated

MN1 Polyclonal antibody

MN1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24697-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, ELISA

MGCR, MGCR1, MGCR1 PEN, Transcriptional activator MN1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, U2OS cells
Positive IHC detected inmouse skeletal muscle tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24697-1-AP targets MN1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20344

Product name: Recombinant human MN1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 978-1320 aa of BC156879

Sequence: QQQASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGDQPDLIGSLDGGAKSDSSSPNVGEFASDEVSTSYANEDEVSSSSDNPQALVKASRSPLVTGSPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGGGGGPGHPGTPGLEQVRTPTSSSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGASGAQNGDSELGSCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT

Predict reactive species
Full Name meningioma (disrupted in balanced translocation) 1
Calculated Molecular Weight 1320 aa, 136 kDa
Observed Molecular Weight136 kDa
GenBank Accession NumberBC156879
Gene Symbol MN1
Gene ID (NCBI) 4330
RRIDAB_2879678
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ10571
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MN1 (Transcriptional activator MN1), which is mainly located in nucleus. Highest expression is observed in fetal brain and skeletal muscle, and adult skeletal muscle. MN1 protein can interact with Brg1/Brm related factor (BAF) complex containing Smarca4/Brg1 and stabilize it on chromatin, thus maintaining the expression of hematopoietic progenitor cell-like genes. Under normal physiological conditions, MN1 protein is mainly expressed in granulocyte monocyte progenitor cells (GMP) in hematopoietic system, which plays an important role in the development and function of hematopoietic cells, and it is involved in regulating cell proliferation, differentiation, apoptosis and embryonic development. MN1 protein is related to many diseases, especially in leukemia (PMID: 23049943). MN1 gene rearrangements such as t(12; 22)(p13; Q11) can produce MN1-TEL fusion protein, which combines the transcriptional activation domain of MN1 and the DNA binding domain of TEL(ETV6), and can stably occupy the TEL recognition sequence, hindering the combination of normal transcription regulatory factors, thus leading to leukemia. Overexpression of MN1 gene has also been proved to be one of the signs of poor prognosis in patients with acute myeloid leukemia (AML), and its expression level is high in AML patients with normal karyotype. The molecular weight of MN1 is 136 kDa.

Protocols

Product Specific Protocols
IHC protocol for MN1 antibody 24697-1-APDownload protocol
WB protocol for MN1 antibody 24697-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC,IF

Nat Commun

Astroblastomas exhibit radial glia stem cell lineages and differential expression of imprinted and X-inactivation escape genes.

Authors - Norman L Lehman
humanWB,IHC

EBioMedicine

METTL14-mediated epitranscriptome modification of MN1 mRNA promote tumorigenicity and all-trans-retinoic acid resistance in osteosarcoma.

Authors - Hong-Bo Li
  • KD Validated

Front Immunol

Characterization of cancer-related fibroblasts in bladder cancer and construction of CAFs-based bladder cancer classification: insights from single-cell and multi-omics analysis

Authors - Zhaokai Zhou
humanWB

J Transl Med

Modulation of DAPK1 expression by its alternative splice variant DAPK1-215 in cancer

Authors - QingShui Wang
human,zebrafishWB

Front Immunol

The role of the LncRNA XIST/miR-15a-5p/MN1 signaling axis in gender disparities in bladder cancer prognosis

Authors - Fangzhen Cai
humanIHC

Acta Neuropathol

MN1 immunohistochemistry is a sensitive diagnostic biomarker for primitive CNS tumors with MN1 fusion

Authors - Roxane Daniel
Loading...
||
New chat

Able

正在加载,请稍候...