MN1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MN1 Polyclonal antibody, PBS Only (24697-1-PBS)

• 

  WB analysis using 24697-1-AP (same clone as 24697-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24697-1-AP (MN1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 24697-1-AP (same clone as 24697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 24697-1-AP (MN1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 24697-1-AP (same clone as 24697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 24697-1-AP (MN1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24697-1-AP (same clone as 24697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 24697-1-AP (MN1 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24697-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 24697-1-AP (same clone as 24697-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle slide using 24697-1-AP (MN1 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24697-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MN1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24697-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

MGCR, MGCR1, MGCR1 PEN, Transcriptional activator MN1

---

Product Information

24697-1-PBS targets MN1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20344

  Product name: Recombinant human MN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 978-1320 aa of BC156879

  Sequence: QQQASGAAVGGSSAGETRGAPTPHEKALTSPSWGKGAELLLGDQPDLIGSLDGGAKSDSSSPNVGEFASDEVSTSYANEDEVSSSSDNPQALVKASRSPLVTGSPKLPPRGVGAGEHGPKAPPPALGLGIMSNSTSTPDSYGGGGGPGHPGTPGLEQVRTPTSSSGAPPPDEIHPLEILQAQIQLQRQQFSISEDQPLGLKGGKKGECAVGASGAQNGDSELGSCCSEAVKSAMSTIDLDSLMAEHSAAWYMPADKALVDSADDDKTLAPWEKAKPQNPNSKEAHDLPANKASASQPGSHLQCLSVHCTDDVGDAKARASVPTWRSLHSDISNRFGTFVAALT

• Full Name: meningioma (disrupted in balanced translocation) 1
• Calculated Molecular Weight: 1320 aa, 136 kDa
• Observed Molecular Weight: 136 kDa
• GenBank Accession Number: BC156879
• Gene Symbol: MN1
• Gene ID (NCBI): 4330
• RRID: AB_2879678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q10571
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MN1 (Transcriptional activator MN1), which is mainly located in nucleus. Highest expression is observed in fetal brain and skeletal muscle, and adult skeletal muscle. MN1 protein can interact with Brg1/Brm related factor (BAF) complex containing Smarca4/Brg1 and stabilize it on chromatin, thus maintaining the expression of hematopoietic progenitor cell-like genes. Under normal physiological conditions, MN1 protein is mainly expressed in granulocyte monocyte progenitor cells (GMP) in hematopoietic system, which plays an important role in the development and function of hematopoietic cells, and it is involved in regulating cell proliferation, differentiation, apoptosis and embryonic development. MN1 protein is related to many diseases, especially in leukemia (PMID: 23049943). MN1 gene rearrangements such as t(12; 22)(p13; Q11) can produce MN1-TEL fusion protein, which combines the transcriptional activation domain of MN1 and the DNA binding domain of TEL(ETV6), and can stably occupy the TEL recognition sequence, hindering the combination of normal transcription regulatory factors, thus leading to leukemia. Overexpression of MN1 gene has also been proved to be one of the signs of poor prognosis in patients with acute myeloid leukemia (AML), and its expression level is high in AML patients with normal karyotype. The molecular weight of MN1 is 136 kDa.