MOBKL1A Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 12790-1-AP (same clone as 12790-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12790-1-AP (MOBKL1A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12790-1-PBS in a different storage buffer formulation.

• 

  IP experiment of Jurkat using 12790-1-AP (same clone as 12790-1-PBS)

  IP result of anti-MOBKL1A (IP:12790-1-AP, 4ug; Detection:12790-1-AP 1:1000) with Jurkat cells lysate 2800ug. This data was developed using the same antibody clone with 12790-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 12790-1-AP (same clone as 12790-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12790-1-AP (MOBKL1A antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12790-1-PBS in a different storage buffer formulation.

MOBKL1A Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12790-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12790-1-PBS targets MOBKL1A in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3509

  Product name: Recombinant human MOBKL1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-216 aa of BC038112

  Sequence: MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTSKDR

• Full Name: MOB1, Mps One Binder kinase activator-like 1A (yeast)
• Calculated Molecular Weight: 216 aa, 25 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC038112
• Gene Symbol: MOBKL1A
• Gene ID (NCBI): 92597
• RRID: AB_2266566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L9L4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.