MOBP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MOBP Polyclonal antibody (12472-1-AP)

MOBP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12472-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MOBP

• 

  WB analysis of mouse brain using 12472-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12472-1-AP (MOBP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12472-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12472-1-AP (MOBP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 12472-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12472-1-AP (MOBP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12472-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12472-1-AP (MOBP antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12472-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12472-1-AP (MOBP antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MOBP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human gliomas tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:300-1:600
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12472-1-AP targets MOBP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3156

  Product name: Recombinant human MOBP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC022471

  Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL

• Full Name: myelin-associated oligodendrocyte basic protein
• Calculated Molecular Weight: 183 aa, 21 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC022471
• Gene Symbol: MOBP
• Gene ID (NCBI): 4336
• RRID: AB_10644161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13875
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MOBP polyclonal antibody (Cat# 12472-1-AP) has 3 published citations. These appear in Neurobiology of Disease, Glia, and Bioengineered. The associated research fields include CNS remyelination and cAMP signaling pathway modulation, oligodendrocyte differentiation and myelin/axon integrity, and glioblastoma multiforme biomarker identification. Applications cited are Western blot and IHC across human, mouse, and rat species.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Neurobiol Dis; Inhibition of CXCR2 enhances CNS remyelination via modulating PDE10A/cAMP signaling pathway; Authors - Cheng Ju
mouse	WB	Glia; ST8SIA2 promotes oligodendrocyte differentiation and the integrity of myelin and axons.; Authors - Lukasz Mateusz Szewczyk
human	IHC	Bioengineered; Four specific biomarkers associated with the progression of glioblastoma multiforme in older adults identified using weighted gene co-expression network analysis; Authors - Yushi Yang