Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IHC detected in | human gliomas tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:600 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IHC | See 1 publications below |
Product Information
12472-1-AP targets MOBP in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3156 Product name: Recombinant human MOBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC022471 Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL Predict reactive species |
Full Name | myelin-associated oligodendrocyte basic protein |
Calculated Molecular Weight | 183 aa, 21 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC022471 |
Gene Symbol | MOBP |
Gene ID (NCBI) | 4336 |
RRID | AB_10644161 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13875 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MOBP antibody 12472-1-AP | Download protocol |
IHC protocol for MOBP antibody 12472-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Neurobiol Dis Inhibition of CXCR2 enhances CNS remyelination via modulating PDE10A/cAMP signaling pathway | ||
Glia ST8SIA2 promotes oligodendrocyte differentiation and the integrity of myelin and axons. | ||
Bioengineered Four specific biomarkers associated with the progression of glioblastoma multiforme in older adults identified using weighted gene co-expression network analysis |