Product Information
12472-1-PBS targets MOBP in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3156 Product name: Recombinant human MOBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC022471 Sequence: MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRL Predict reactive species |
| Full Name | myelin-associated oligodendrocyte basic protein |
| Calculated Molecular Weight | 183 aa, 21 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC022471 |
| Gene Symbol | MOBP |
| Gene ID (NCBI) | 4336 |
| RRID | AB_10644161 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13875 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |









