MOG Recombinant monoclonal antibody

MOG Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 83063-6-RR
Clone No.250235E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA

MOGIG 2, Myelin-oligodendrocyte glycoprotein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue, pig brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83063-6-RR targets MOG in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2878

Product name: Recombinant Human MOG protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 30-154 aa of N/A

Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Predict reactive species
Full Name myelin oligodendrocyte glycoprotein
Calculated Molecular Weight24 kDa
Observed Molecular Weight 25-28 kDa
GenBank Accession NumberN/A
Gene Symbol MOG
Gene ID (NCBI) 4340
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16653-1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Myelin/oligodendrocyte glycoprotein (MOG), a 23~28 kDa glycoprotein, a myelin antigen at the outer surface of the central nervous system (CNS) myelin sheath, which may trigger T-cell as well as B-cell responses. It therefore constitutes a pivotal target for autoimmune responses, which result in inflammation and also demyelination in the CNS. Its presence on the outer- most lamellae of mature CNS myelin and its late appearance during myelinogenesis suggest that it contributes to myelin maturation or maintenance. 10 isoforms of MOG produced by alternative splicing have been described, and heterodimers may be formed between the different isoforms. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7), a neurological disabling sleep disorder characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Role of MOG in the pathogenesis of multiple sclerosis (MS) has been reported but remains to be clarified.

Protocols

Product Specific Protocols
WB protocol for MOG antibody 83063-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...