MOG Recombinant monoclonal antibody, PBS Only

MOG Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA
Cat No. 83063-6-PBS
Clone No.250235E1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

MOGIG 2, Myelin-oligodendrocyte glycoprotein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83063-6-PBS targets MOG in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2878

Product name: Recombinant Human MOG protein (rFc Tag) (HPLC verified)

Source: mammalian cells-derived, V37

Tag: C-rFc

Domain: 30-154 aa of N/A

Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

Predict reactive species
Full Name myelin oligodendrocyte glycoprotein
Calculated Molecular Weight24 kDa
Observed Molecular Weight 25-28 kDa
GenBank Accession NumberN/A
Gene Symbol MOG
Gene ID (NCBI) 4340
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16653-1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Myelin/oligodendrocyte glycoprotein (MOG), a 23~28 kDa glycoprotein, a myelin antigen at the outer surface of the central nervous system (CNS) myelin sheath, which may trigger T-cell as well as B-cell responses. It therefore constitutes a pivotal target for autoimmune responses, which result in inflammation and also demyelination in the CNS. Its presence on the outer- most lamellae of mature CNS myelin and its late appearance during myelinogenesis suggest that it contributes to myelin maturation or maintenance. 10 isoforms of MOG produced by alternative splicing have been described, and heterodimers may be formed between the different isoforms. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7), a neurological disabling sleep disorder characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Role of MOG in the pathogenesis of multiple sclerosis (MS) has been reported but remains to be clarified.

Loading...
||
New chat

Able

正在加载,请稍候...