Product Information
83063-6-PBS targets MOG in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg2878 Product name: Recombinant Human MOG protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 30-154 aa of N/A Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG Predict reactive species |
| Full Name | myelin oligodendrocyte glycoprotein |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 25-28 kDa |
| GenBank Accession Number | N/A |
| Gene Symbol | MOG |
| Gene ID (NCBI) | 4340 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q16653-1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Myelin/oligodendrocyte glycoprotein (MOG), a 23~28 kDa glycoprotein, a myelin antigen at the outer surface of the central nervous system (CNS) myelin sheath, which may trigger T-cell as well as B-cell responses. It therefore constitutes a pivotal target for autoimmune responses, which result in inflammation and also demyelination in the CNS. Its presence on the outer- most lamellae of mature CNS myelin and its late appearance during myelinogenesis suggest that it contributes to myelin maturation or maintenance. 10 isoforms of MOG produced by alternative splicing have been described, and heterodimers may be formed between the different isoforms. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7), a neurological disabling sleep disorder characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Role of MOG in the pathogenesis of multiple sclerosis (MS) has been reported but remains to be clarified.

