Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, HEK-293 cells, Jurkat cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26454-1-AP targets MOS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24585 Product name: Recombinant human MOS protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 31-150 aa of BC069569 Sequence: PAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQV Predict reactive species |
| Full Name | v-mos Moloney murine sarcoma viral oncogene homolog |
| Calculated Molecular Weight | 346 aa, 38 kDa |
| Observed Molecular Weight | 34-38 kDa |
| GenBank Accession Number | BC069569 |
| Gene Symbol | MOS |
| Gene ID (NCBI) | 4342 |
| RRID | AB_3085874 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00540 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mos is a germ cell-specific serine/threonine protein kinase, can induce oncogenic transformation of somatic cells by direct phosphorylation of MAP kinase/ERK kinase (MEK1), activating the mitogen-activated protein kinases ERK1 and ERK2.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MOS antibody 26454-1-AP | Download protocol |
| IHC protocol for MOS antibody 26454-1-AP | Download protocol |
| WB protocol for MOS antibody 26454-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









