• Featured Product
  • KD/KO Validated

MOSC2 Recombinant monoclonal antibody, PBS Only (Capture)

MOSC2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83705-2-PBS
Clone No.240747G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

240747G6, EC:1.7.-.-, mARC2, Mitochondrial amidoxime reducing component 2, Moco sulfurase C-terminal domain-containing protein 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83705-2-PBS targets MOSC2 as part of a matched antibody pair:

MP00646-2: 83705-2-PBS capture and 83705-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20694

Product name: Recombinant human MOSC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 118-229 aa of BC011973

Sequence: YENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEK

Predict reactive species
Full Name MOCO sulphurase C-terminal domain containing 2
Calculated Molecular Weight 335 aa, 38 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC011973
Gene Symbol MOSC2
Gene ID (NCBI) 54996
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ969Z3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MOSC domain-containing protein 2 (also known as MOSC2), also known as MARC2, is a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. Also, MOSC2 may be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. The reductase activity is regulated under adipogenic conditions, and down-regulation of the terminal component MOSC2 resulted in decreased lipid synthesis, suggesting a possible physiological role of this enzyme system and its component MOSC2 in lipogenesis(PMID: 22203676).

Loading...
||
New chat Able
正在加载,请稍候...