MOSC2 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 83705-2-RR (same clone as 83705-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83705-2-RR (MOSC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83705-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 83705-2-RR (same clone as 83705-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83705-2-RR (MOSC2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83705-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 83705-2-RR (same clone as 83705-2-PBS)

  WB result of MOSC2 antibody (83705-2-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-MOSC2 transfected HEK-293 cells. This data was developed using the same antibody clone with 83705-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 83705-2-RR (same clone as 83705-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83705-2-RR (MOSC2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83705-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 83705-2-RR (same clone as 83705-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83705-2-RR (MOSC2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83705-2-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 83705-2-RR (same clone as 83705-2-PBS)

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug MOSC2 Recombinant antibody (83705-2-RR, Clone:240747G6) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83705-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP00646-2

  Cytometric bead array standard curve of MP00646-2, MOSC2 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83705-2-PBS. Detection antibody: 83705-1-PBS. Standard: Ag20694. Range: 0.313-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 83705-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83705-2-RR against Human MOSC2 were performed. The affinity constant is 0.473 nM.

• Featured Product
• KD/KO Validated

MOSC2 Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 83705-2-PBS

Clone No.240747G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

240747G6, EC:1.7.-.-, mARC2, Mitochondrial amidoxime reducing component 2, Moco sulfurase C-terminal domain-containing protein 2

---

Product Information

83705-2-PBS targets MOSC2 as part of a matched antibody pair:

MP00646-2: 83705-2-PBS capture and 83705-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20694

  Product name: Recombinant human MOSC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 118-229 aa of BC011973

  Sequence: YENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEK

• Full Name: MOCO sulphurase C-terminal domain containing 2
• Calculated Molecular Weight: 335 aa, 38 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC011973
• Gene Symbol: MOSC2
• Gene ID (NCBI): 54996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q969Z3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MOSC domain-containing protein 2 (also known as MOSC2), also known as MARC2, is a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. Also, MOSC2 may be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. The reductase activity is regulated under adipogenic conditions, and down-regulation of the terminal component MOSC2 resulted in decreased lipid synthesis, suggesting a possible physiological role of this enzyme system and its component MOSC2 in lipogenesis(PMID: 22203676).