• Featured Product
  • KD/KO Validated

MOSC2 Recombinant monoclonal antibody

MOSC2 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83705-2-RR
Clone No.240747G6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

240747G6, EC:1.7.-.-, mARC2, Mitochondrial amidoxime reducing component 2, Moco sulfurase C-terminal domain-containing protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, HEK-293 cells, HUVEC cells, mouse kidney tissue, rat liver tissue
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83705-2-RR targets MOSC2 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20694

Product name: Recombinant human MOSC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 118-229 aa of BC011973

Sequence: YENNCLIFRAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAKWFTNFLKTEAYRLVQFETNMKGRTSRKLLPTLDQNFQVAYPDYCPLLIMTDASLVDLNTRMEK

Predict reactive species
Full Name MOCO sulphurase C-terminal domain containing 2
Calculated Molecular Weight 335 aa, 38 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC011973
Gene Symbol MOSC2
Gene ID (NCBI) 54996
RRIDAB_3671307
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ969Z3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MOSC domain-containing protein 2 (also known as MOSC2), also known as MARC2, is a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. Also, MOSC2 may be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. The reductase activity is regulated under adipogenic conditions, and down-regulation of the terminal component MOSC2 resulted in decreased lipid synthesis, suggesting a possible physiological role of this enzyme system and its component MOSC2 in lipogenesis(PMID: 22203676).

Protocols

Product Specific Protocols
FC protocol for MOSC2 antibody 83705-2-RRDownload protocol
IHC protocol for MOSC2 antibody 83705-2-RRDownload protocol
WB protocol for MOSC2 antibody 83705-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...