MPP6 Polyclonal antibody, PBS Only

• 

  WB analysis using 11575-1-AP (same clone as 11575-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11575-1-AP (MPP6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11575-1-AP (same clone as 11575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11575-1-AP (MPP6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11575-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 11575-1-AP (same clone as 11575-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11575-1-AP (MPP6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11575-1-PBS in a different storage buffer formulation.

MPP6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11575-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11575-1-PBS targets MPP6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2158

  Product name: Recombinant human MPP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-540 aa of BC023638

  Sequence: PLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY

• Full Name: membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
• Calculated Molecular Weight: 540 aa, 61 kDa
• Observed Molecular Weight: 55-61 kDa
• GenBank Accession Number: BC023638
• Gene Symbol: MPP6
• Gene ID (NCBI): 51678
• RRID: AB_2250848
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZW5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.