MPP6 Polyclonal antibody

• 

  WB analysis using 11575-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11575-1-AP (MPP6 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 11575-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11575-1-AP (MPP6 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 11575-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 11575-1-AP (MPP6 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MPP6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11575-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MAGUK p55 subfamily member 6, MPP6, p55T, PALS2, VAM 1, VAM1, Veli associated MAGUK 1

---

Tested Applications

• Positive WB detected in: HepG2 cells, SMMC-7721 cells
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

11575-1-AP targets MPP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2158

  Product name: Recombinant human MPP6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 140-540 aa of BC023638

  Sequence: PLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY

• Full Name: membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
• Calculated Molecular Weight: 540 aa, 61 kDa
• Observed Molecular Weight: 55-61 kDa
• GenBank Accession Number: BC023638
• Gene Symbol: MPP6
• Gene ID (NCBI): 51678
• RRID: AB_2250848
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZW5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Nan Fang Yi Ke Da Xue Xue Bao; [High expression of MPP6 predicts poor patient prognosis and promotes malignant biological behaviors of hepatocellular carcinoma cells].; Authors - 余晖豪 ; KD Validated
human	WB,IHC	Front Immunol; Elevated MPP6 expression correlates with an unfavorable prognosis, angiogenesis and immune evasion in hepatocellular carcinoma; Authors - Qianqian Cheng
human	WB	Front Cell Dev Biol; Divergent roles of circMPP6 and its parental gene MPP6 in non-small cell lung cancer.; Authors - Weijuan Gao