Mouse MPZL3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86803-1-RR (same clone as 86803-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86803-1-RR (MPZL3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86803-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86803-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86803-1-RR against Mouse MPZL3 were performed. The affinity constant is 1.79 nM.

MPZL3 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86803-1-PBS

Clone No.251621F6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, Indirect ELISA

Synonyms

myelin protein zero-like 3

---

Product Information

86803-1-PBS targets MPZL3 in WB, Indirect ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg6821

  Product name: Recombinant mouse MPZL3 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 33-158 aa of NM_001093749.2

  Sequence: LEISADAHVRGYVGEKIKLKCTFKSSSDVTDKLTIDWTYRPPSSSRTESIFHYQSFQYPTTAGTFRDRISWAGNVYKGDASISISNPTLKDNGTFSCAVKNPPDVYHNIPLTELTVTERGFGTMLSS

• Full Name: myelin protein zero-like 3
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 70 kDa, 28 kDa
• GenBank Accession Number: NM_001093749.2
• Gene Symbol: Mpzl3
• Gene ID (NCBI): 319742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q3V3F6-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MPZL3(Myelin Protein Zero Like 3) is a transmembrane protein belonging to the myelin protein zero (MPZ) gene family. It acts upstream of or within extracellular matrix organization and hair cycle. Predicted to be located in membrane. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in lung cancer. Orthologous to human MPZL3 (myelin protein zero like 3).