Tested Applications
Positive WB detected in | mouse brain tissue, mouse lung tissue, human brain tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IF | See 1 publications below |
Product Information
14213-1-AP targets MRAS in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5433 Product name: Recombinant human MRAS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC047690 Sequence: MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQWAILDVLDTAG Predict reactive species |
Full Name | muscle RAS oncogene homolog |
Calculated Molecular Weight | 24 kDa |
Observed Molecular Weight | 24 kDa |
GenBank Accession Number | BC047690 |
Gene Symbol | MRAS |
Gene ID (NCBI) | 22808 |
RRID | AB_10950895 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O14807 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MRAS antibody 14213-1-AP | Download protocol |
IP protocol for MRAS antibody 14213-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Rep Mutation-induced LZTR1 polymerization provokes cardiac pathology in recessive Noonan syndrome | ||
Stem Cell Res Generation of a genetically-modified induced pluripotent stem cell line harboring a Noonan syndrome-associated gene variant MRAS p.G23V |