MRGPRD Polyclonal antibody

• 

  IHC staining of mouse small intestine using 23640-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 23640-1-AP (MRGPRD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat dorsal root ganglion using 23640-1-AP

  Immunohistochemical analysis of paraffin-embedded rat dorsal root ganglion tissue slide using 23640-1-AP (MRGPRD antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse small intestine using 23640-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using MRGPRD antibody (23640-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse small intestine using 23640-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using MRGPRD antibody (23640-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MRGPRD Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 23640-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, ELISA

Synonyms

Beta alanine receptor, Beta-alanine receptor, G-protein coupled receptor TGR7, MAS related GPR, member D, Mas-related G-protein coupled receptor member D

---

Tested Applications

• Positive IHC detected in: mouse small intestine tissue, rat dorsal root ganglion tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse small intestine tissue

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23640-1-AP targets MRGPRD in IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20316

  Product name: Recombinant human MRGPRD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 230-321 aa of BC156660

  Sequence: FLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA

• Full Name: MAS-related GPR, member D
• Calculated Molecular Weight: 321 aa, 36 kDa
• GenBank Accession Number: BC156660
• Gene Symbol: MRGPRD
• Gene ID (NCBI): 116512
• RRID: AB_3669414
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q8TDS7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRGPRD (MAS-related G-protein coupled receptor, D), also referred to as hGPCR45 or TGR7, was identified as a novel GPCR in murine and human genomes. As for MRGD, its expression was found in dorsal root ganglia (DRG) and co-localized with Vanilloid receptor-1 (VR-1), which is an essential receptor for heat and pain sensation (PMID: 22715397).