MRGPRE Polyclonal antibody

• 

  IHC staining of rat dorsal root ganglion using 28080-1-AP

  Immunohistochemical analysis of paraffin-embedded rat dorsal root ganglion tissue slide using 28080-1-AP (MRGPRE antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat dorsal root ganglion using 28080-1-AP

  Immunohistochemical analysis of paraffin-embedded rat dorsal root ganglion tissue slide using 28080-1-AP (MRGPRE antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MRGPRE Polyclonal Antibody for IHC, ELISA

Cat No. 28080-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat

Applications

IHC, ELISA

Synonyms

G protein coupled receptor 167, GPR167, MAS related GPR, member E, MRGE, MRGPRE

---

Tested Applications

• Positive IHC detected in: rat dorsal root ganglion tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28080-1-AP targets MRGPRE in IHC, ELISA applications and shows reactivity with Human, rat samples.

• Tested Reactivity: Human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24913

  Product name: Recombinant human MRGPRE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 262-311 aa of BC104889

  Sequence: AAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVRETSRRGLVDIAA

• Full Name: MAS-related GPR, member E
• Calculated Molecular Weight: 311 aa, 34 kDa
• GenBank Accession Number: BC104889
• Gene Symbol: MRGPRE
• Gene ID (NCBI): 116534
• RRID: AB_3669642
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86SM8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MRGPRE (Mas-related G-protein coupled receptor member E, also named GPR167 ) may regulate nociceptor function or development, including the sensation or modulation of pain.