Product Information
17946-1-PBS targets MRGPRX3 in IHC, Indirect ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12417 Product name: Recombinant human MRGPRX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 240-322 aa of BC067292 Sequence: SRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGQLPQETLELSGSRLEQ Predict reactive species |
Full Name | MAS-related GPR, member X3 |
Calculated Molecular Weight | 322 aa, 36 kDa |
GenBank Accession Number | BC067292 |
Gene Symbol | MRGPRX3 |
Gene ID (NCBI) | 117195 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96LB0 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
MRGPRX3 (Mas-related G-protein coupled receptor member X3) is a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. MRGPRX3 may be involved in sensory neuron regulation and in the modulation of pain.