MRGPRX3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MRGPRX3 Polyclonal antibody, PBS Only (17946-1-PBS)

MRGPRX3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 17946-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

IHC, Indirect ELISA

Synonyms

MAS related GPR, member X3, Mas-related G-protein coupled receptor member X3, MRGX3, Sensory neuron-specific G-protein coupled receptor 1/2, SNSR1

• 

  IHC staining of rat dorsal root ganglion using 17946-1-AP (same clone as 17946-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat dorsal root ganglion tissue slide using 17946-1-AP (MRGPRX3 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17946-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

17946-1-PBS targets MRGPRX3 in IHC, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12417

  Product name: Recombinant human MRGPRX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 240-322 aa of BC067292

  Sequence: SRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGQLPQETLELSGSRLEQ

• Full Name: MAS-related GPR, member X3
• Calculated Molecular Weight: 322 aa, 36 kDa
• GenBank Accession Number: BC067292
• Gene Symbol: MRGPRX3
• Gene ID (NCBI): 117195
• RRID: AB_3669284
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LB0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MRGPRX3 (Mas-related G-protein coupled receptor member X3) is a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. MRGPRX3 may be involved in sensory neuron regulation and in the modulation of pain.