MRPL35 Polyclonal antibody

• 

  WB analysis using 27339-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27339-1-AP (MRPL35 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 27339-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27339-1-AP (MRPL35 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 27339-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27339-1-AP (MRPL35 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 27339-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MRPL35 antibody (27339-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

MRPL35 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 27339-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

MRPL 35, MRP L35, L35mt

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse liver tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27339-1-AP targets MRPL35 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26300

  Product name: Recombinant human MRPL35 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 61-170 aa of BC020651

  Sequence: TTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTTSFWKRRN

• Full Name: mitochondrial ribosomal protein L35
• Calculated Molecular Weight: 170 aa, 19 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC020651
• Gene Symbol: MRPL35
• Gene ID (NCBI): 51318
• RRID: AB_3669593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZE8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial ribosomal protein L35 (MRPL35) is a member of the large subunit family of mitochondrial ribosomal proteins. It plays a key role in the assembly of cytochrome C oxidase, involved in the translation of mitochondrial proteins.