Tested Applications
| Positive WB detected in | mouse heart tissue, mouse liver tissue |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27339-1-AP targets MRPL35 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26300 Product name: Recombinant human MRPL35 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 61-170 aa of BC020651 Sequence: TTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTTSFWKRRN Predict reactive species |
| Full Name | mitochondrial ribosomal protein L35 |
| Calculated Molecular Weight | 170 aa, 19 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC020651 |
| Gene Symbol | MRPL35 |
| Gene ID (NCBI) | 51318 |
| RRID | AB_3669593 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NZE8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Mitochondrial ribosomal protein L35 (MRPL35) is a member of the large subunit family of mitochondrial ribosomal proteins. It plays a key role in the assembly of cytochrome C oxidase, involved in the translation of mitochondrial proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MRPL35 antibody 27339-1-AP | Download protocol |
| IHC protocol for MRPL35 antibody 27339-1-AP | Download protocol |
| WB protocol for MRPL35 antibody 27339-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







