MRPL37 Polyclonal antibody, PBS Only

• 

  WB analysis using 29522-1-AP (same clone as 29522-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29522-1-AP (MRPL37 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29522-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 29522-1-AP (same clone as 29522-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29522-1-AP (MRPL37 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29522-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 29522-1-AP (same clone as 29522-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MRPL37 antibody (29522-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 29522-1-PBS in a different storage buffer formulation.

MRPL37 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 29522-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

29522-1-PBS targets MRPL37 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31452

  Product name: Recombinant human MRPL37 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-273 aa of BC000041

  Sequence: KQALWLTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHPSLARRICVQNSTFSATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDV

• Full Name: mitochondrial ribosomal protein L37
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000041
• Gene Symbol: MRPL37
• Gene ID (NCBI): 51253
• RRID: AB_2918321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZE1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.