MRPL37 Polyclonal antibody

• 

  WB analysis using 29522-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29522-1-AP (MRPL37 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 29522-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29522-1-AP (MRPL37 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 29522-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MRPL37 antibody (29522-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

MRPL37 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29522-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MRP L37, MRP L2, Large ribosomal subunit protein mL37, L37mt, L2mt

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, U-251 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29522-1-AP targets MRPL37 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31452

  Product name: Recombinant human MRPL37 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-273 aa of BC000041

  Sequence: KQALWLTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHPSLARRICVQNSTFSATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDV

• Full Name: mitochondrial ribosomal protein L37
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000041
• Gene Symbol: MRPL37
• Gene ID (NCBI): 51253
• RRID: AB_2918321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZE1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.