MRPL37 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MRPL37 Polyclonal antibody (29522-1-AP)

MRPL37 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29522-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MRP L37, MRP L2, Large ribosomal subunit protein mL37, L37mt, L2mt

• 

  WB analysis using 29522-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29522-1-AP (MRPL37 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 29522-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 29522-1-AP (MRPL37 antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 29522-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using MRPL37 antibody (29522-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MRPL37 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, U-251 cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:3000
• Immunohistochemistry (IHC): IHC : 1:150-1:600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29522-1-AP targets MRPL37 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31452

  Product name: Recombinant human MRPL37 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 118-273 aa of BC000041

  Sequence: KQALWLTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHPSLARRICVQNSTFSATWNRESLLLQVRGSGGARLSTKDPLPTIASREEIEATKNHVLETFYPISPIIDLHECNIYDV

• Full Name: mitochondrial ribosomal protein L37
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000041
• Gene Symbol: MRPL37
• Gene ID (NCBI): 51253
• RRID: AB_2918321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZE1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MRPL37 Polyclonal antibody (Cat# 29522-1-AP) has 1 total citation. The cited publication appeared in iScience (IF 4.5, 2025), investigating how MRPL37 promotes hepatocellular carcinoma progression through modulating mitochondrial energy metabolism. The research field is cancer biology, specifically liver cancer and mitochondrial metabolism.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	iScience; MRPL37 promotes hepatocellular carcinoma progression through modulating mitochondrial energy metabolism.; Authors - Yigan Zhang ; KD Validated