Product Information
15183-1-AP targets MRPL51 in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag7193 Product name: Recombinant human MRPL51 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC000191 Sequence: MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR Predict reactive species | 
                                    
| Full Name | mitochondrial ribosomal protein L51 | 
| Calculated Molecular Weight | 15 kDa | 
| GenBank Accession Number | BC000191 | 
| Gene Symbol | MRPL51 | 
| Gene ID (NCBI) | 51258 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q4U2R6 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
