MRPS33 Polyclonal antibody

• 

  WB analysis using 17162-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17162-1-AP (MRPS33 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of mouse liver using 17162-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using MRPS33 antibody (17162-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MRPS33 Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 17162-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF-P, ELISA

Synonyms

CGI 139, CGI139, CGI-139, MRP S33, MRPS 33

---

Tested Applications

• Positive WB detected in: HEK-293 cells
• Positive IF-P detected in: mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17162-1-AP targets MRPS33 in WB, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10566

  Product name: Recombinant human MRPS33 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-106 aa of BC015462

  Sequence: SSLSEYAFRMSRLSARLFGEVTRPTNSKSMKVVKLFSELPLAKKKETYDWYPNHHTYAELMQTLRFLGLYRDEHQDFMDEQKRLKKLRGKEKPKKGEGKRAAKRK

• Full Name: mitochondrial ribosomal protein S33
• Calculated Molecular Weight: 106 aa, 13 kDa
• Observed Molecular Weight: 13-15 kDa
• GenBank Accession Number: BC015462
• Gene Symbol: MRPS33
• Gene ID (NCBI): 51650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y291
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.