Use Able AI chat for product recommendations

MRPS35 Polyclonal antibody

MRPS35 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 16457-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

HDCMD11P, MDS023, MRP S28, MRP S35, MRPS28

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, human heart tissue, HepG2 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16457-1-AP targets MRPS35 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9430

Product name: Recombinant human MRPS35 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-323 aa of BC015862

Sequence: MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT

Predict reactive species
Full Name mitochondrial ribosomal protein S35
Calculated Molecular Weight 323 aa, 37 kDa
Observed Molecular Weight 37 kDa
GenBank Accession NumberBC015862
Gene Symbol MRPS35
Gene ID (NCBI) 60488
RRIDAB_2146521
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP82673
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mammalian mitochondrial ribosomes (mitoribosomes) are responsible for protein synthesis within the mitochondrion. The mitoribosomes are composed of a 4:1 ratio of protein to RNA, with the proteins forming two subunits, the 28S subunit and the 39S subunit. Across species, the proteins that make up the mitoribosome subunits vary greatly in sequence, preventing easy recognition by sequence homology. MRPS35 (mitochondrial ribosomal protein S35), also known as MDS023, MRPS28 or HDCMD11P, is a 323 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 28S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis. Existing as two alternatively spliced isoforms, MRPS35 is encoded by a gene located on human chromosome 10, which houses over 1,200 genes and comprises nearly 4.5% of the human genome. This antibody is a rabbit polyclonal antibody raised against the full length MRPS35 protein. It specifically reacts with the 37kd MRPS35protein.

Protocols

Product Specific Protocols
IF protocol for MRPS35 antibody 16457-1-APDownload protocol
IHC protocol for MRPS35 antibody 16457-1-APDownload protocol
IP protocol for MRPS35 antibody 16457-1-APDownload protocol
WB protocol for MRPS35 antibody 16457-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Metab

Integrative genetic analysis identifies FLVCR1 as a plasma-membrane choline transporter in mammals

Authors - Timothy C Kenny
mouseWB

Sci Adv

Adult-onset obesity is triggered by impaired mitochondrial gene expression.

Authors - Kara L Perks
mouseWB

Sci Adv

Fidelity of translation initiation is required for coordinated respiratory complex assembly.

Authors - Danielle L Rudler
WB

Cell Metab

Tissue-Specific Loss of DARS2 Activates Stress Responses Independently of Respiratory Chain Deficiency in the Heart.

Authors - Sukru Anil Dogan
mouseWB

J Clin Invest

AFG3L2 supports mitochondrial protein synthesis and Purkinje cell survival.

Authors - Almajan Eva R ER
mouseWB

Nat Commun

Loss of the RNA-binding protein TACO1 causes late-onset mitochondrial dysfunction in mice.

Authors - Tara R Richman

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Monifa (Verified Customer) (12-06-2025)

I could detect the mitoribosome small subunit clearly from fractions of a sucrose gradient. The polysome profiling needs optimization but the antibody gave good signal.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: 293T cells
Loading...
||
New chat

Able

正在加载,请稍候...