Tested Applications
Positive WB detected in | SH-SY5Y cells, mouse skeletal muscle tissue, rat skeletal muscle tissue |
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13293-1-AP targets MS4A12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3968 Product name: Recombinant human MS4A12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC029793 Sequence: MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINPSVGTAVMNFKEEAKALGVIQIMVGL Predict reactive species |
Full Name | membrane-spanning 4-domains, subfamily A, member 12 |
Calculated Molecular Weight | 267 aa, 28 kDa |
Observed Molecular Weight | 35 kDa |
GenBank Accession Number | BC029793 |
Gene Symbol | MS4A12 |
Gene ID (NCBI) | 54860 |
RRID | AB_10596915 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NXJ0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MS4A12 antibody 13293-1-AP | Download protocol |
IHC protocol for MS4A12 antibody 13293-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |