Filter: AllWBIHC

WB analysis using 13293-1-AP
SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13293-1-AP (MS4A12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis using 13293-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 13293-1-AP (MS4A12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IHC staining of human colon cancer using 13293-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13293-1-AP (MS4A12 Antibody) at dilution of 1:50.
IHC staining of human colon cancer using 13293-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13293-1-AP (MS4A12 Antibody) at dilution of 1:50.

MS4A12 Polyclonal antibody

Name: MS4A12 Polyclonal antibody
Brand: Proteintech
SKU: 13293-1-AP

MS4A12 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13293-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Membrane-spanning 4-domains subfamily A member 12

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

Positive WB detected in	SH-SY5Y cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
Positive IHC detected in	human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Application	Dilution
Western Blot (WB)	WB : 1:300-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

IHC	See 1 publications below

13293-1-AP targets MS4A12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3968 Product name: Recombinant human MS4A12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC029793 Sequence: MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINPSVGTAVMNFKEEAKALGVIQIMVGL Predict reactive species
Full Name	membrane-spanning 4-domains, subfamily A, member 12
Calculated Molecular Weight	267 aa, 28 kDa
Observed Molecular Weight	35 kDa
GenBank Accession Number	BC029793
Gene Symbol	MS4A12
Gene ID (NCBI)	54860
RRID	AB_10596915
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NXJ0
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Product Specific Protocols
IHC protocol for MS4A12 antibody 13293-1-AP	Download protocol
WB protocol for MS4A12 antibody 13293-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Species	Application	Title
human	IHC	Radiat Oncol Elevated MS4A12 expression is indicative of resistance to concurrent chemoradiotherapy and inferior survival in patients with rectal cancer. Authors - Chih-I Chen View Article