MS4A12 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MS4A12 Polyclonal antibody (13293-1-AP)

MS4A12 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13293-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Membrane-spanning 4-domains subfamily A member 12

• 

  WB analysis using 13293-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13293-1-AP (MS4A12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13293-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13293-1-AP (MS4A12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 13293-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13293-1-AP (MS4A12 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 13293-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13293-1-AP (MS4A12 Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MS4A12 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13293-1-AP targets MS4A12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3968

  Product name: Recombinant human MS4A12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of BC029793

  Sequence: MMSSKPTSHAEVNETIPNPYPPSSFMAPGFQQPLGSINLENQAQGAQRAQPYGITSPGIFASSQPGQGNIQMINPSVGTAVMNFKEEAKALGVIQIMVGL

• Full Name: membrane-spanning 4-domains, subfamily A, member 12
• Calculated Molecular Weight: 267 aa, 28 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC029793
• Gene Symbol: MS4A12
• Gene ID (NCBI): 54860
• RRID: AB_10596915
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NXJ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-MS4A12 antibody (catalog #13293-1-AP) has 1 total citation. It appears in Radiation Oncology (2025), where researchers investigated elevated MS4A12 expression as an indicator of resistance to concurrent chemoradiotherapy and its association with inferior survival in rectal cancer patients. The study applied the antibody via IHC in human tissue samples, placing it within the research fields of oncology and radiation therapy resistance.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Radiat Oncol; Elevated MS4A12 expression is indicative of resistance to concurrent chemoradiotherapy and inferior survival in patients with rectal cancer.; Authors - Chih-I Chen