MS4A2 Polyclonal antibody

• 

  WB analysis using 26808-1-AP

  mouse lung tissue lysates were subjected to SDS PAGE followed by western blot with 26808-1-AP (MS4A2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

MS4A2 Polyclonal Antibody for WB, ELISA

Cat No. 26808-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

APY, ATOPY, FCER1B, FCERI, IgE Fc receptor subunit beta, IGEL, IGER, IGHER, MS4A1, MS4A2

---

Tested Applications

• Positive WB detected in: mouse lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26808-1-AP targets MS4A2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25196

  Product name: Recombinant human MS4A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC074843

  Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDI

• Full Name: membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide)
• Calculated Molecular Weight: 244 aa, 27 kDa
• Observed Molecular Weight: 25-27 kDa
• GenBank Accession Number: BC074843
• Gene Symbol: MS4A2
• Gene ID (NCBI): 2206
• RRID: AB_3085906
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q01362
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MS4A is a new gene family with four transmembrane-spanning domains and is crucial for cell differentiation, signaling, and cell cycle control. The membrane-spanning 4 domains, superfamily A, number 2 gene (MS4A2, also named as the beta-chain of the high affinity IgE receptor or FcεRIβ gene, FCER1B), as a member of the MS4A family, is a component of the high-affinity IgE receptor, with co-immunoprecipitation experiments demonstrating that it associates with FcɛRIα and FcRγ to form a tetrameric receptor complex (αβγ2) that is expressed on mast cells and basophils at high density(PMID: 25835430). MS4A2 is strongly associated with the prognosis of lung adenocarcinoma and lung cancer brain metastases(PMID: 37533433).