Tested Applications
Positive WB detected in | mouse lung tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26808-1-AP targets MS4A2 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25196 Product name: Recombinant human MS4A2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC074843 Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDI Predict reactive species |
Full Name | membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, high affinity I, receptor for; beta polypeptide) |
Calculated Molecular Weight | 244 aa, 27 kDa |
Observed Molecular Weight | 25-27 kDa |
GenBank Accession Number | BC074843 |
Gene Symbol | MS4A2 |
Gene ID (NCBI) | 2206 |
RRID | AB_3085906 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01362 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MS4A is a new gene family with four transmembrane-spanning domains and is crucial for cell differentiation, signaling, and cell cycle control. The membrane-spanning 4 domains, superfamily A, number 2 gene (MS4A2, also named as the beta-chain of the high affinity IgE receptor or FcεRIβ gene, FCER1B), as a member of the MS4A family, is a component of the high-affinity IgE receptor, with co-immunoprecipitation experiments demonstrating that it associates with FcɛRIα and FcRγ to form a tetrameric receptor complex (αβγ2) that is expressed on mast cells and basophils at high density(PMID: 25835430). MS4A2 is strongly associated with the prognosis of lung adenocarcinoma and lung cancer brain metastases(PMID: 37533433).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MS4A2 antibody 26808-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |