MSH2 Monoclonal antibody, PBS Only (Capture/Detector)

MSH2 Monoclonal Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 60161-2-PBS
Clone No.2E4A7

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

2E4A7, MSH 2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60161-2-PBS targets MSH2 as part of a matched antibody pair:

MP50235-1: 60161-1-PBS capture and 60161-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

MP50235-2: 60161-2-PBS capture and 60161-3-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7835

Product name: Recombinant human MSH2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 585-934 aa of BC021566

Sequence: SSGYVEPMQTLNDVLAQLDAVVSFAHVSNGAPVPYVRPAILEKGQGRIILKASRHACVEVQDEIAFIPNDVYFEKDKQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLKGVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMFATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT

Predict reactive species
Full Name mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli)
Calculated Molecular Weight 105 kDa
Observed Molecular Weight105 kDa
GenBank Accession NumberBC021566
Gene Symbol MSH2
Gene ID (NCBI) 4436
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP43246
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MSH2, named for its homologous to the E.coli MutS gene, takes part in DNA mismatch repair(MMR) to maintain the stability of DNA. MSH2 contains a helix-turn-helix domain, which responds for binding to DNA. Also, MSH2 has a direct role in mutation avoidance and micro-satellite stability in cell.

Loading...
||
New chat

Able

正在加载,请稍候...