MSMB Recombinant monoclonal antibody

• 

  WB analysis of human urine using 87375-1-RR

  human urine sample were subjected to SDS PAGE followed by western blot with 87375-1-RR (MSMB antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87375-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87375-1-RR against Human MSMB were performed. The affinity constant is 0.764 nM.

MSMB Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87375-1-RR

Clone No.252111A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Beta microseminoprotein, Beta-microseminoprotein, HPC13, Immunoglobulin-binding factor, PSP-94

---

Tested Applications

• Positive WB detected in: human urine sample

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87375-1-RR targets MSMB in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8674

  Product name: Recombinant human MSMB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 25-114 aa of BC005257

  Sequence: IPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII

• Full Name: microseminoprotein, beta-
• Calculated Molecular Weight: 114 aa, 13 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC005257
• Gene Symbol: MSMB
• Gene ID (NCBI): 4477
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P08118
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MSMB is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in the uterus, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer.