Product Information
16526-1-AP targets MT1F in ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9766 Product name: Recombinant human MT1F protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC029453 Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD Predict reactive species |
| Full Name | metallothionein 1F |
| Calculated Molecular Weight | 61 aa, 6 kDa |
| GenBank Accession Number | BC029453 |
| Gene Symbol | MT1F |
| Gene ID (NCBI) | 4494 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04733 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
