MT1F Polyclonal antibody

• 

MT1F Polyclonal Antibody for ELISA

Cat No. 16526-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

ELISA

Synonyms

metallothionein 1F, Metallothionein IF, MT 1F, MT IF, MT1, MT1F

---

Product Information

16526-1-AP targets MT1F in ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9766

  Product name: Recombinant human MT1F protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-61 aa of BC029453

  Sequence: MDPNCSCAAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCSKCAQGCVCKGASEKCSCCD

• Full Name: metallothionein 1F
• Calculated Molecular Weight: 61 aa, 6 kDa
• GenBank Accession Number: BC029453
• Gene Symbol: MT1F
• Gene ID (NCBI): 4494
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04733
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.