Tested Applications
| Positive IHC detected in | human liver tissue, human hepatocirrhosis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 7 publications below |
Product Information
17172-1-AP targets MT1X in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10711 Product name: Recombinant human MT1X protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-46 aa of BC032131 Sequence: MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSECRAFPANLGDGPI Predict reactive species |
| Full Name | metallothionein 1X |
| Calculated Molecular Weight | 46 aa, 5 kDa |
| GenBank Accession Number | BC032131 |
| Gene Symbol | MT1X |
| Gene ID (NCBI) | 4501 |
| RRID | AB_2878354 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P80297 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MT1X antibody 17172-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Autophagy Therapeutic targeting of the USP2-E2F4 axis inhibits autophagic machinery essential for zinc homeostasis in cancer progression. | ||
Cancer Res Intratumoral Copper Modulates PD-L1 Expression and Influences Tumor Immune Evasion. | ||
J Cell Mol Med Comprehensive analysis of partial epithelial mesenchymal transition-related genes in hepatocellular carcinoma. | ||
Cancer Biol Ther MiR-376a-3p increases cell apoptosis in acute myeloid leukemia by targeting MT1X. | ||
Cell Death Dis Comparison of the major cell populations among osteoarthritis, Kashin-Beck disease and healthy chondrocytes by single-cell RNA-seq analysis. | ||
Poult Sci The capability of L-carnitine-mediated antioxidant on cock during aging: evidence for the improved semen quality and enhanced testicular expressions of GnRH1, GnRHR, and melatonin receptors MT 1/2. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Adrianna (Verified Customer) (10-31-2022) | There is a lot of unspecific bands with this antibody and I cannot see the actual band being brighter. I have used it at 1:1000 dilution, and incubated ON at 4 deg C. Perhaps I should try a different dilution / lysate concentration.
|
