MTCH2 Polyclonal antibody

• 

  WB analysis using 16888-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16888-1-AP (MTCH2 antibody) at dilution of 1:7000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 16888-1-AP

  IP result of anti-MTCH2 (IP:16888-1-AP, 3ug; Detection:16888-1-AP 1:1000) with HepG2 cells lysate 4000ug.

• 

  IHC staining of human liver using 16888-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16888-1-AP (MTCH2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 16888-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16888-1-AP (MTCH2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of rat testis using 16888-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat testis tissue using MTCH2 antibody (16888-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of rat testis using 16888-1-AP

  Immunofluorescent analysis of (4% PFA) fixed rat testis tissue using MTCH2 antibody (16888-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of U-251 using 16888-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using MTCH2 antibody (16888-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

MTCH2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 16888-1-AP

Publications(24)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

Synonyms

HSPC032, Met-induced mitochondrial protein, MIMP

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat testis tissue
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:14000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 9 publications below
• WB: See 22 publications below
• IHC: See 5 publications below
• IF: See 5 publications below
• CoIP: See 2 publications below

Product Information

16888-1-AP targets MTCH2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10399

  Product name: Recombinant human MTCH2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 31-178 aa of BC000875

  Sequence: GYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGF

• Full Name: mitochondrial carrier homolog 2 (C. elegans)
• Calculated Molecular Weight: 303 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000875
• Gene Symbol: MTCH2
• Gene ID (NCBI): 23788
• RRID: AB_2266733
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6C9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Triaging of α-helical proteins to the mitochondrial outer membrane by distinct chaperone machinery based on substrate topology; Authors - Gayathri Muthukumar ; KD Validated
	WB	Sci Adv; ARMC1 partitions between distinct complexes and assembles MIRO with MTFR to control mitochondrial distribution; Authors - Michael J McKenna
human	WB,IHC	Cell Death Dis; MTCH2 regulates NRF2-mediated RRM1 expression to promote melanoma proliferation and dacarbazine insensitivity; Authors - Xuedan Zhang ; KD Validated
human	WB,IF	J Cell Biol; The modified mitochondrial outer membrane carrier MTCH2 links mitochondrial fusion to lipogenesis.; Authors - Katherine Labbé
pig	WB	FASEB J; MTCH2 promotes adipogenesis in intramuscular preadipocytes via an m6A-YTHDF1-dependent mechanism.; Authors - Qin Jiang
human	WB	RNA Biol; Reprogramming of m6A epitranscriptome is crucial for shaping of transcriptome and proteome in response to hypoxia.; Authors - Yan-Jie Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xianhe (Verified Customer) (06-23-2022)

WB band is strong and clear, IFA image binding great.

• Applications: Western Blot, Immunofluorescence