Tested Applications
| Positive IF/ICC detected in | U-251 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-16888 targets MTCH2 in IF/ICC applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag10399 Product name: Recombinant human MTCH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 31-178 aa of BC000875 Sequence: GYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGF Predict reactive species | 
                                    
| Full Name | mitochondrial carrier homolog 2 (C. elegans) | 
| Calculated Molecular Weight | 303 aa, 33 kDa | 
| Observed Molecular Weight | 33 kDa | 
| GenBank Accession Number | BC000875 | 
| Gene Symbol | MTCH2 | 
| Gene ID (NCBI) | 23788 | 
| RRID | AB_3083994 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9Y6C9 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 MTCH2 antibody CL488-16888 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

