Tested Applications
Positive IP detected in | HEK-293T cells |
Positive IF/ICC detected in | U2OS cells |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
10235-1-AP targets MTCP1NB in IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0338 Product name: Recombinant human MTCP1NB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 6-68 aa of BC002600 Sequence: PCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK Predict reactive species |
Full Name | mature T-cell proliferation 1 neighbor |
Calculated Molecular Weight | 13 kDa, 8 kDa |
Observed Molecular Weight | 8 kDa |
GenBank Accession Number | BC002600 |
Gene Symbol | MTCP1NB |
Gene ID (NCBI) | 100272147 |
RRID | AB_2189123 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P56277 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MTCP1NB, also named as C6.1B, MTCP1, MTCP1B, is a member of the CMC4 protein family. MTCP1NB is 8 kDa protein that localizes to mitochondria. MTCP1NB was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations(NCBI).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for MTCP1NB antibody 10235-1-AP | Download protocol |
IP protocol for MTCP1NB antibody 10235-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |