MTCP1NB Polyclonal antibody, PBS Only

• 

  IP experiment of HEK-293T using 10235-1-AP (same clone as 10235-1-PBS)

  IP result of anti-MTCP1NB (IP:10235-1-AP, 4ug; Detection:10235-1-AP 1:300) with HEK-293T cells lysate 1320 ug. This data was developed using the same antibody clone with 10235-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 10235-1-AP (same clone as 10235-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using MTCP1NB antibody (10235-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10235-1-PBS in a different storage buffer formulation.

MTCP1NB Polyclonal Antibody for IF/ICC, IP, Indirect ELISA

Cat No. 10235-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

10235-1-PBS targets MTCP1NB in IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0338

  Product name: Recombinant human MTCP1NB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 6-68 aa of BC002600

  Sequence: PCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK

• Full Name: mature T-cell proliferation 1 neighbor
• Calculated Molecular Weight: 13 kDa, 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC002600
• Gene Symbol: MTCP1NB
• Gene ID (NCBI): 100272147
• RRID: AB_2189123
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56277
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MTCP1NB, also named as C6.1B, MTCP1, MTCP1B, is a member of the CMC4 protein family. MTCP1NB is 8 kDa protein that localizes to mitochondria. MTCP1NB was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations(NCBI).