MTH1 Monoclonal antibody, PBS Only (Capture)

MTH1 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67443-1-PBS
Clone No.2D7G4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

NUDT1, 2D7G4, 2-hydroxy-dATP diphosphatase, 7,8-dihydro-8-oxoguanine triphosphatase, 8 oxo dGTPase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67443-1-PBS targets MTH1 as part of a matched antibody pair:

MP50783-2: 67443-1-PBS capture and 67443-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9802

Product name: Recombinant human NUDT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-179 aa of BC014618

Sequence: MSGISPQQMGEPEGSWSGKNPGTMGASRLYTLVLVLQPQRVLLGMKKRGFGAGRWNGFGGKVQEGETIEDGARRELQEESGLTVDALHKVGQIVFEFVGEPELMDVHVFCTDSIQGTPVESDEMRPCWFQLDQIPFKDMWPDDSYWFPLLLQKKKFHGYFKFQGQDTILDYTLREVDTV

Predict reactive species
Full Name nudix (nucleoside diphosphate linked moiety X)-type motif 1
Calculated Molecular Weight179aa,20 kDa; 197aa,23 kDa
Observed Molecular Weight 19 kDa
GenBank Accession NumberBC014618
Gene Symbol MTH1
Gene ID (NCBI) 4521
RRIDAB_2882678
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP36639
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MTH1, also known as NUDT1 or 8-Oxo-dGTPase, is an important repair enzyme that prevents oxidative stress-induced DNA damage through hydrolyzing mutagenic 8-oxo-dGTP into 8-oxo-dGMP. MTH1 is expressed in postmitotic neurons as well as in proliferative tissues, and it is localized both in the mitochondria and nucleus. MTH1 might be a useful marker of oxidative stress and its level increased upon oxidative stress. Increased expression of MTH1 were also found in various cancer tissues and neurodegenerative diseases.

Loading...
||
New chat

Able

正在加载,请稍候...