MTNR1A Recombinant monoclonal antibody, PBS Only

• 

MTNR1A Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 83234-1-PBS

Clone No.240005A1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

MEL 1A R, Mel1a receptor, Mel-1A-R, melatonin receptor 1A, Melatonin receptor type 1A

---

Product Information

83234-1-PBS targets MTNR1A in Cytometric bead array, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24198

  Product name: Recombinant human MTNR1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-42 aa of BC074947

  Sequence: MQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDI

• Full Name: melatonin receptor 1A
• Calculated Molecular Weight: 350 aa, 39 kDa
• GenBank Accession Number: BC074947
• Gene Symbol: MTNR1A
• Gene ID (NCBI): 4543
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48039
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.