MUC20 Polyclonal antibody

MUC20 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 30457-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

KIAA1359, MUC 20, MUC-20, Mucin-20, UNQ2782/PRO7170

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, mouse liver tissue
Positive IHC detected inrat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30457-1-AP targets MUC20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31867

Product name: Recombinant human MUC20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 400-555 aa of BC029267

Sequence: IEAGSAVGKTTSFAGSSASSYSPSEAALKNFTPSETLTTDIATKGPFPTSRDPLPSVPPTTTNSSRGTNSTLAKITTSAKTTMKPPTATPTTARTRPTTDMSAGENGGFLLLRLSVASPEDLTDPRVAERLMQQLHRELHAHAPHFQVSLLRVRRG

Predict reactive species
Full Name mucin 20, cell surface associated
Calculated Molecular Weight 55 kDa, 71 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC029267
Gene Symbol MUC20
Gene ID (NCBI) 200958
RRIDAB_3086323
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N307
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MUC20 contains serine, threonine, and proline-rich repeats in its extracellular domain and is likely to be extensively O-glycosylated. MUC20 blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway and inhibiting HGF-induced proliferation of MMP1 and MMP9 expression (PMID: 15314156). MUC20 is highly expressed in the kidney and localized in the proximal tubules but not in the glomerulus or distal tubules(PMID: 14565953). MUC20 was detected in most of the male urogenital tract epithelia, except for epididymis(PMID: 16997931). The expression of MUC20 is up-regulated in the kidneys of patients with immunoglobulin A nephropathy, in an animal model of lupus nephritis, and in mice with acute renal injury caused by cisplatin administration or unilateral ureteral obstruction(PMID: 14565953).

Protocols

Product Specific Protocols
IF protocol for MUC20 antibody 30457-1-APDownload protocol
IHC protocol for MUC20 antibody 30457-1-APDownload protocol
WB protocol for MUC20 antibody 30457-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...