MUC20 Polyclonal antibody, PBS Only

MUC20 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 30457-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

30457-1-PBS targets MUC20 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31867

Product name: Recombinant human MUC20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 400-555 aa of BC029267

Sequence: IEAGSAVGKTTSFAGSSASSYSPSEAALKNFTPSETLTTDIATKGPFPTSRDPLPSVPPTTTNSSRGTNSTLAKITTSAKTTMKPPTATPTTARTRPTTDMSAGENGGFLLLRLSVASPEDLTDPRVAERLMQQLHRELHAHAPHFQVSLLRVRRG

Predict reactive species
Full Name mucin 20, cell surface associated
Calculated Molecular Weight 55 kDa, 71 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC029267
Gene Symbol MUC20
Gene ID (NCBI) 200958
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N307
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MUC20 contains serine, threonine, and proline-rich repeats in its extracellular domain and is likely to be extensively O-glycosylated. MUC20 blocks GRB2 recruitment to MET thus suppressing the GRB2-RAS pathway and inhibiting HGF-induced proliferation of MMP1 and MMP9 expression (PMID: 15314156). MUC20 is highly expressed in the kidney and localized in the proximal tubules but not in the glomerulus or distal tubules(PMID: 14565953). MUC20 was detected in most of the male urogenital tract epithelia, except for epididymis(PMID: 16997931). The expression of MUC20 is up-regulated in the kidneys of patients with immunoglobulin A nephropathy, in an animal model of lupus nephritis, and in mice with acute renal injury caused by cisplatin administration or unilateral ureteral obstruction(PMID: 14565953).

Loading...
||
New chat Able
正在加载,请稍候...