Tested Applications
| Positive WB detected in | MCF-7 cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30408-1-AP targets MUC5AC in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30190 Product name: Recombinant human MUC5AC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 5545-5654 aa of NM_001304359 Sequence: GCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQHSEEAEPEPSQEAESGSWERGVPVSPMH Predict reactive species |
| Full Name | mucin 5AC, oligomeric mucus/gel-forming |
| Calculated Molecular Weight | 586 kDa |
| Observed Molecular Weight | 290 kDa |
| GenBank Accession Number | NM_001304359 |
| Gene Symbol | MUC5AC |
| Gene ID (NCBI) | 4586 |
| RRID | AB_3669718 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P98088 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MUC5AC (Mucin-5AC ) is a gel-forming glycoprotein of the gastric and respiratory epithelium. It can protect mucous membranes from infection and chemical damage by binding to inhaled microorganisms and particles, which are then cleared by the mucociliary system. (PubMed:14535999,PubMed:14718370)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MUC5AC antibody 30408-1-AP | Download protocol |
| WB protocol for MUC5AC antibody 30408-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









