MUL1 Polyclonal antibody

• 

  WB analysis of HeLa using 16133-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16133-1-AP (MUL1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 16133-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16133-1-AP (MUL1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 16133-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16133-1-AP (MUL1 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

MUL1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16133-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

C1orf166, GIDE, MAPL, MUL1, MULAN, RING finger protein 218, RNF218, RP11 401M16.2

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 11 publications below
• IHC: See 2 publications below
• IP: See 3 publications below
• CoIP: See 1 publications below

Product Information

16133-1-AP targets MUL1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9119

  Product name: Recombinant human MUL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-239 aa of BC010101

  Sequence: SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL

• Full Name: mitochondrial E3 ubiquitin ligase 1
• Calculated Molecular Weight: 352 aa, 40 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC010101
• Gene Symbol: MUL1
• Gene ID (NCBI): 79594
• RRID: AB_2147111
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q969V5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial ubiquitin ligase 1 (MUL1),MAPL, MULAN, or gGIDE, was identified as an E3 protein ligase by three independent groups. Work in mammalian systems shows that MUL1 has small ubiquitin-like modifier (SUMO) ligase activity, stabilizing Drp1, or ubiquitin ligase activity, degrading Mfn. MUL1 expression in mammalian cells results in smaller and more fragmented mitochondria.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; PHB2 promotes SHIP2 ubiquitination via the E3 ligase NEDD4 to regulate AKT signaling in gastric cancer; Authors - Liang Xu
rat	WB	Oxid Med Cell Longev; Inhibition of Prostaglandin E2 Receptor EP3 Attenuates Oxidative Stress and Neuronal Apoptosis Partially by Modulating p38MAPK/FOXO3/Mul1/Mfn2 Pathway after Subarachnoid Hemorrhage in Rats; Authors - Yu Liu
mouse	WB	Life Sci; Trichostatin A inhibits skeletal muscle atrophy induced by cigarette smoke exposure in mice.; Authors - Jingjing Ding
human,mouse	WB	Eur J Pharmacol; Mitochondrial E3 ubiquitin ligase 1 promotes brain injury by disturbing mitochondrial dynamics in a rat model of ischemic stroke.; Authors - Kai-Di Ren ; KD Validated
rat	CoIP	Can J Physiol Pharmacol; Upregulation of mitochondrial E3 ubiquitin ligase 1 in rat heart contributes to ischemia/reperfusion injury.; Authors - Shi-Jing Wang
rat	WB,IP	J Ginseng Res; Ginsenoside compound K protects against cerebral ischemia/reperfusion injury via Mul1/Mfn2-mediated mitochondrial dynamics and bioenergy; Authors - Qingxia Huang