MUL1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP02942-1

  The mean MUL1 concentration was determined to be 893.20 ng/mL in SH-SY5Y cell extract based on a 1.2 mg/mL extract load, 617.00 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load and 477.35 ng/mL in THP-1 cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02942-1

  Sandwich ELISA standard curve of MP02942-1, Human MUL1 Recombinant Matched Antibody Pair - PBS only. 87235-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag9119. 87235-1-PBS was HRP conjugated as the detection antibody. Range: 0.781-50 ng/mL

MUL1 Uni-rAb^® Recombinant Antibody for Sandwich ELISA, Indirect ELISA

Cat No. 87235-2-PBS

Clone No.252482E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

87235-2-PBS targets MUL1 as part of a matched antibody pair:

MP02942-1: 87235-2-PBS capture and 87235-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9119

  Product name: Recombinant human MUL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-239 aa of BC010101

  Sequence: SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL

• Full Name: mitochondrial E3 ubiquitin ligase 1
• Calculated Molecular Weight: 352 aa, 40 kDa
• GenBank Accession Number: BC010101
• Gene Symbol: MUL1
• Gene ID (NCBI): 79594
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q969V5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.