Use Able AI chat for product recommendations

MUL1 Recombinant monoclonal antibody, PBS Only (Detector)

MUL1 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 87235-1-PBS
Clone No.252482F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87235-1-PBS targets MUL1 as part of a matched antibody pair:

MP02942-1: 87235-2-PBS capture and 87235-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9119

Product name: Recombinant human MUL1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-239 aa of BC010101

Sequence: SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL

Predict reactive species
Full Name mitochondrial E3 ubiquitin ligase 1
Calculated Molecular Weight 352 aa, 40 kDa
Observed Molecular Weight35-41 kDa
GenBank Accession NumberBC010101
Gene Symbol MUL1
Gene ID (NCBI) 79594
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ969V5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mitochondrial ubiquitin ligase 1 (MUL1),MAPL, MULAN, or gGIDE, was identified as an E3 protein ligase by three independent groups. Work in mammalian systems shows that MUL1 has small ubiquitin-like modifier (SUMO) ligase activity, stabilizing Drp1, or ubiquitin ligase activity, degrading Mfn. MUL1 expression in mammalian cells results in smaller and more fragmented mitochondria.

Loading...
||
New chat

Able

正在加载,请稍候...